Gene selection and protein identification
The gene information were collected from (13)
This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms (13)
protein sequence identification
>NP_001263628.1 cellular tumor antigen p53 isoform l [Homo sapiens]
MAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDC
TTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHEL
PPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQMLLDLRWCYFLINSS (1)
rs1483922249 SNP:
the nuclic acid change was C > T was result in a new amino acid at position 359 which called Leucine and this change was considerd neutral according to PhD-SNP,SNP&GO,PROVEAN while had Large increase stability according to I-Mutant(14;15;16;17)
rs 909643864 SNP:
the nuclic acid change at C > T result in anew amino acid (Leucine) at position
300 and this change was considerd neutral according to PhD-SNP,SNP&GO,PROVEAN while had neutral stability according to I-Mutant. (14;15;16;17)
Rs1367492395 Snp:
the nuclic acid change at C > A result in anew amino acid (Arginie) at position
313 and this change was considerd neutral according to SNP&GO,PROVEAN while had Deleterious affect according to PROVEAN decrease stability according to I-Mutant. (14;15;16;17)
Rs 1177881399 Snp:
the nuclic acid change at A > G result in anew amino acid (G) glycine at position
324 and this change was considerd Deleterious, Disease, Disease according to PhD-SNP,SNP&GO,PROVEAN decrease stability according to I-Mutant (14;15;16;17)
Rs774269719 Snp:
the nuclic acid change was A > T was result in a new amino acid at position 377 which called Serine and this change was considerd neutral according to PhD-SNP,SNP&GO,PROVEAN while had Large increase large stability according to I-Mutant (14;15;16;17)
Rs 866775781 Snp:
the nuclic acid change was G > T was result in a new amino acid at position 132 which called Argenine and this change was considerd deleterious ,disease,disease according to PhD-SNP,SNP&GO,PROVEAN while had Large increase stability according to I-Mutant (14;15;16;17)
Rs1260903787 Snp:
the nuclic acid change was A > G was result in a new amino acid at position 204 which called G (glycine) and this change was considerd deleterious ,disease,disease according to PhD-SNP,SNP&GO,PROVEAN while had Large decrease large stability according to I-Mutant(14;15;16;17)
Rs864622237 Snp:
the nuclic acid change was T > G was result in a new amino acid at position 234 which called D and this change was considerd deleterious ,disease,disease according to PhD-SNP,SNP&GO,PROVEAN while had decrease large stability according to I-Mutant(14;15;16;17)
Rs 864622115 Snp:
the nuclic acid change was A > G was result in a new amino acid at position 174 which called G(glycine) and this change was considerd deleterious ,disease,disease according to PhD-SNP,SNP&GO,PROVEAN while had Large increase large stability according to I-Mutant(14;15;16;17)
Rs 863224687 Snp:
the nuclic acid change was C > T was result in a new amino acid at position 359 which called Leucine and this change was considerd neutral according to PhD-SNP,SNP&GO,PROVEAN while had Large increasestability I-Mutant (14;15;16;17)